AP4M1 Antibody - C-terminal region : FITC (ARP67367_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


AP4M1 Antibody - C-terminal region : FITC (ARP67367_P050-FITC)
Gene Aliases:
MU-4, CPSQ3, SPG50, MU-ARP2Gene ID:
9179Swiss Prot:
O00189Accession Number:
NP_004713Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1Target:
This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system.Partner Proteins:
UBC; USP47; CHTF8; DDX52; ZBTB22; GRID2; CACNG3; TGOLN2; LAMP2; CD63; GRIN2A; GRIN2B; ARF1; AP4E1; AP4B1Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
50kDaShipping Conditions:
Wet IceProtein Length:
453NCBI Gene Symbol:
AP4M1NCBI GB Accession Number:
AP4M1Host or Source:
RabbitProtein Name:
AP-4 complex subunit mu-1Nucleotide Accession Number:
NM_004722Peptide Sequence:
QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSSubunit:
Mu-1
