INTU Antibody - C-terminal region : HRP (ARP67141_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


INTU Antibody - C-terminal region : HRP (ARP67141_P050-HRP)
Gene Aliases:
INT, OFD17, PDZD6, PDZK6, SRTD20, CPLANE4Gene ID:
27152Swiss Prot:
Q9ULD6Accession Number:
NP_056508Host:
RabbitReactivity:
Human, DogImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTUTarget:
INTU plays a key role in ciliogenesis and embryonic development. INTU is a regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. It plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension and has an indirect effect on hedgehog signaling.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Dog: 79%; Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
104kDaShipping Conditions:
Wet IceProtein Length:
942NCBI Gene Symbol:
INTUNCBI GB Accession Number:
INTUHost or Source:
RabbitProtein Name:
Protein inturnedNucleotide Accession Number:
NM_015693Peptide Sequence:
TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD
