ATP6V0D1 Antibody - C-terminal region : FITC (ARP66522_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ATP6V0D1 Antibody - C-terminal region : FITC (ARP66522_P050-FITC)
Gene Aliases:
P39, VATX, VMA6, ATP6D, ATP6DV, VPATPDGene ID:
9114Swiss Prot:
P61421Accession Number:
NP_004682Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATP6V0D1Target:
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.Partner Proteins:
UBC; STAU1; RPA3; RPA2; RPA1; LIG4; ERC1; ATP6V1B1; ATXN1Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
39kDaShipping Conditions:
Wet IceProtein Length:
351NCBI Gene Symbol:
ATP6V0D1NCBI GB Accession Number:
ATP6V0D1Host or Source:
RabbitProtein Name:
V-type proton ATPase subunit d 1Nucleotide Accession Number:
NM_004691Peptide Sequence:
GGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPESubunit:
D 1
