CD96 Antibody - C-terminal region : Biotin (ARP64823_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CD96 Antibody - C-terminal region : Biotin (ARP64823_P050-Biotin)
Gene Name:
CD96 moleculeGene Aliases:
TACTILEGene ID:
10225Swiss Prot:
P40200Accession Number:
NP_937839Host:
RabbitReactivity:
Human, Guinea PigTarget:
The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.Partner Proteins:
PVRClonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Guinea Pig: 92%; Human: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
63kDaShipping Conditions:
Wet IceProtein Length:
585NCBI Gene Symbol:
CD96NCBI GB Accession Number:
CD96Host or Source:
RabbitProtein Name:
T-cell surface protein tactileNucleotide Accession Number:
NM_198196Peptide Sequence:
TTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLH
