PDE4C Antibody - C-terminal region : Biotin (ARP64361_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PDE4C Antibody - C-terminal region : Biotin (ARP64361_P050-Biotin)
Gene Name:
Phosphodiesterase 4C, cAMP-specificGene Aliases:
DPDE1, PDE21Gene ID:
5143Swiss Prot:
Q08493-2Accession Number:
NP_001092289Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, RabbitTarget:
The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.Partner Proteins:
SRI; UBCClonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 79%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
68kDaShipping Conditions:
Wet IceProtein Length:
606NCBI Gene Symbol:
PDE4CNCBI GB Accession Number:
PDE4CHost or Source:
RabbitProtein Name:
CAMP-specific 3',5'-cyclic phosphodiesterase 4CNucleotide Accession Number:
NM_001098819Peptide Sequence:
RIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETW
