SUMF1 Antibody - C-terminal region : FITC (ARP64171_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SUMF1 Antibody - C-terminal region : FITC (ARP64171_P050-FITC)
Gene Name:
Sulfatase modifying factor 1Gene Aliases:
FGE, UNQ3037, AAPA3037Gene ID:
285362Swiss Prot:
Q8NBK3Accession Number:
NP_877437Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishTarget:
This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.Partner Proteins:
UBCClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
40kDaShipping Conditions:
Wet IceProtein Length:
374NCBI Gene Symbol:
SUMF1NCBI GB Accession Number:
SUMF1Host or Source:
RabbitProtein Name:
Sulfatase-modifying factor 1Nucleotide Accession Number:
NM_182760Peptide Sequence:
YNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYC
