PANK2 Antibody - C-terminal region : HRP (ARP63794_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PANK2 Antibody - C-terminal region : HRP (ARP63794_P050-HRP)
Gene Name:
Pantothenate kinase 2Gene Aliases:
HSS, HARP, PKAN, NBIA1, C20orf48Gene ID:
80025Swiss Prot:
Q9BZ23-3Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PANK2Target:
This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms.Partner Proteins:
UBC; DHX36; QRICH2; LXN; YWHAQ; VDAC1; RASGRF2Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedSample Type:
PANK2 is supported by BioGPS gene expression data to be expressed in HepG2Concentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
49kDaShipping Conditions:
Wet IceProtein Length:
447NCBI Gene Symbol:
PANK2NCBI GB Accession Number:
PANK2Host or Source:
RabbitProtein Name:
Pantothenate kinase 2, mitochondrialPeptide Sequence:
FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK
