IFNGR1 Antibody - C-terminal region : HRP (ARP63741_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IFNGR1 Antibody - C-terminal region : HRP (ARP63741_P050-HRP)
Gene Name:
Interferon gamma receptor 1Gene Aliases:
CD119, IFNGR, IMD27A, IMD27BGene ID:
3459Swiss Prot:
P15260Accession Number:
NP_000407.1Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human IFNGR1Target:
This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
30kDaShipping Conditions:
Wet IceProtein Length:
274NCBI Gene Symbol:
IFNGR1NCBI GB Accession Number:
IFNGR1Host or Source:
RabbitProtein Name:
Interferon gamma receptor 1Nucleotide Accession Number:
NM_000416.2Peptide Sequence:
EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS
