ATP6V1C2 Antibody - C-terminal region : FITC (ARP62325_P050-FITC)

CAT:
247-ARP62325_P050-FITC
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ATP6V1C2 Antibody - C-terminal region : FITC (ARP62325_P050-FITC) - image 1

ATP6V1C2 Antibody - C-terminal region : FITC (ARP62325_P050-FITC)

  • Gene Name:

    ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
  • Gene Aliases:

    VMA5, ATP6C2
  • Gene ID:

    245973
  • Swiss Prot:

    A8KA87
  • Accession Number:

    NP_653184
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
  • Target:

    This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.
  • Partner Proteins:

    GOLGA2
  • Clonality:

    Polyclonal
  • Conjugation:

    FITC: Fluorescein Isothiocyanate
  • Type:

    Polyclonal Antibody
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    42kDa
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    381
  • NCBI Gene Symbol:

    ATP6V1C2
  • NCBI GB Accession Number:

    ATP6V1C2
  • Host or Source:

    Rabbit
  • Protein Name:

    CDNA FLJ77341, highly similar to Homo sapiens ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2 (ATP6V1C2), mRNA EMBL BAF85641.1
  • Nucleotide Accession Number:

    NM_144583
  • Peptide Sequence:

    SEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLN
  • Subunit:

    C 2