ATP6V1C2 Antibody - C-terminal region : FITC (ARP62325_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ATP6V1C2 Antibody - C-terminal region : FITC (ARP62325_P050-FITC)
Gene Name:
ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2Gene Aliases:
VMA5, ATP6C2Gene ID:
245973Swiss Prot:
A8KA87Accession Number:
NP_653184Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, RabbitTarget:
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms.Partner Proteins:
GOLGA2Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
42kDaShipping Conditions:
Wet IceProtein Length:
381NCBI Gene Symbol:
ATP6V1C2NCBI GB Accession Number:
ATP6V1C2Host or Source:
RabbitProtein Name:
CDNA FLJ77341, highly similar to Homo sapiens ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2 (ATP6V1C2), mRNA EMBL BAF85641.1Nucleotide Accession Number:
NM_144583Peptide Sequence:
SEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSubunit:
C 2
