KLRC1 Antibody - C-terminal region : HRP (ARP61288_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


KLRC1 Antibody - C-terminal region : HRP (ARP61288_P050-HRP)
Gene Name:
Killer cell lectin-like receptor subfamily C, member 1Gene Aliases:
NKG2, NKG2A, CD159AGene ID:
3821Swiss Prot:
P26715-2Accession Number:
NP_015567Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human KLRC1Target:
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.Partner Proteins:
PMP22; MAL; KLRD1; PTPN6; PTPN11; HLA-EClonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
24kDaShipping Conditions:
Wet IceProtein Length:
215NCBI Gene Symbol:
KLRC1NCBI GB Accession Number:
KLRC1Host or Source:
RabbitProtein Name:
NKG2-A/NKG2-B type II integral membrane proteinNucleotide Accession Number:
NM_007328Peptide Sequence:
SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH
