PIGC Antibody - C-terminal region : Biotin (ARP60841_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PIGC Antibody - C-terminal region : Biotin (ARP60841_P050-Biotin)
Gene Name:
Phosphatidylinositol glycan anchor biosynthesis, class CGene Aliases:
GPI2, MRT62, GPIBD16Gene ID:
5279Swiss Prot:
Q92535Accession Number:
NP_002633Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PIGCTarget:
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI) lipid anchor biosynthesis. The GPI lipid anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. The encoded protein is one subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum.Partner Proteins:
KLF10; DPM2; ZHX1; PIGQClonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedSample Type:
PIGC is strongly supported by BioGPS gene expression data to be expressed in HEK293TConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
33kDaShipping Conditions:
Wet IceProtein Length:
297NCBI Gene Symbol:
PIGCNCBI GB Accession Number:
PIGCHost or Source:
RabbitProtein Name:
Phosphatidylinositol N-acetylglucosaminyltransferase subunit CNucleotide Accession Number:
NM_002642Peptide Sequence:
AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLSSubunit:
C
