COL9A3 Antibody - C-terminal region : HRP (ARP60028_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


COL9A3 Antibody - C-terminal region : HRP (ARP60028_P050-HRP)
Gene Name:
Collagen, type IX, alpha 3Gene Aliases:
IDD, MED, EDM3, DJ885L7.4.1Gene ID:
1299Swiss Prot:
Q14050Accession Number:
NP_001844Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human COL9A3Target:
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3.Partner Proteins:
EGFR; MAG; COL2A1Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 90%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
63kDaShipping Conditions:
Wet IceProtein Length:
684NCBI Gene Symbol:
COL9A3NCBI GB Accession Number:
COL9A3Host or Source:
RabbitProtein Name:
Collagen alpha-3 (IX) chainNucleotide Accession Number:
NM_001853Peptide Sequence:
PGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
