NETO1 Antibody - C-terminal region : FITC (ARP59810_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NETO1 Antibody - C-terminal region : FITC (ARP59810_P050-FITC)
Gene Name:
Neuropilin (NRP) and tolloid (TLL) -like 1Gene Aliases:
BCTL1, BTCL1Gene ID:
81832Swiss Prot:
Q8R4I7Accession Number:
NP_620416Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1Target:
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Partner Proteins:
BAG3Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
IHC, WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
60kDaShipping Conditions:
Wet IceProtein Length:
533NCBI Gene Symbol:
NETO1NCBI GB Accession Number:
NETO1Host or Source:
RabbitProtein Name:
Neuropilin and tolloid-like protein 1Nucleotide Accession Number:
NM_138966Peptide Sequence:
MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI
