TAAR5 Antibody - C-terminal region : HRP (ARP59626_P050-HRP)

• Gene Name:

  Trace amine associated receptor 5

• Gene Aliases:

  PNR, taR-5

• Gene ID:

  9038

• Swiss Prot:

  O14804

• Accession Number:

  NP_003958

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

• Immunogen:

  The immunogen is a synthetic peptide directed towards the C terminal region of human TAAR5

• Target:

  TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.

• Clonality:

  Polyclonal

• Conjugation:

  HRP: Horseradish Peroxidase

• Type:

  Polyclonal Antibody

• Applications:

  IF, WB

• Purification:

  Affinity Purified

• Sample Type:

  TAAR5 is supported by BioGPS gene expression data to be expressed in PANC1

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 100%

• Format:

  Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  38kDa

• Shipping Conditions:

  Wet Ice

• Protein Length:

  337

• NCBI Gene Symbol:

  TAAR5

• NCBI GB Accession Number:

  TAAR5

• Host or Source:

  Rabbit

• Protein Name:

  Trace amine-associated receptor 5

• Nucleotide Accession Number:

  NM_003967

• Peptide Sequence:

  TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP