Scamp1 Antibody - N-terminal region : Biotin (ARP59466_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Scamp1 Antibody - N-terminal region : Biotin (ARP59466_P050-Biotin)
Gene Name:
Secretory carrier membrane protein 1Gene Aliases:
AI415563, AW122395, 4930505M11RikGene ID:
107767Swiss Prot:
Q8K021Accession Number:
NP_083429Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishTarget:
Scamp1 functions in post-Golgi recycling pathways. It acts as a recycling carrier to the cell surface.Partner Proteins:
SypClonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
38kDaShipping Conditions:
Wet IceProtein Length:
338NCBI Gene Symbol:
SCAMP1NCBI GB Accession Number:
Scamp1Host or Source:
RabbitProtein Name:
Secretory carrier-associated membrane protein 1Nucleotide Accession Number:
NM_029153Peptide Sequence:
GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA
