Klf15 Antibody - N-terminal region : HRP (ARP58002_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Klf15 Antibody - N-terminal region : HRP (ARP58002_P050-HRP)
Gene Aliases:
CKL, KKL, CKLF, KKLF, hlb44, hlb444, AV048136, AW494632, 1810013I09RikGene ID:
66277Swiss Prot:
Q9EPW2Accession Number:
NP_075673Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Klf15Target:
The function of this protein remains unknown.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 91%; Human: 100%; Mouse: 93%; Rat: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
44kDaShipping Conditions:
Wet IceProtein Length:
415NCBI Gene Symbol:
KLF15NCBI GB Accession Number:
Klf15Host or Source:
RabbitProtein Name:
Krueppel-like factor 15Nucleotide Accession Number:
NM_023184Peptide Sequence:
MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC
