Necab1 Antibody - C-terminal region : FITC (ARP57628_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Necab1 Antibody - C-terminal region : FITC (ARP57628_P050-FITC)
Gene Name:
N-terminal EF-hand calcium binding protein 1Gene Aliases:
STI, NECA, Efcbp, Efcbp1, STIP-1, 1700003H21RikGene ID:
69352Swiss Prot:
Q8BG18Accession Number:
NP_848732Host:
RabbitReactivity:
Human, Mouse, Rat, Dog, Guinea Pig, Horse, RabbitTarget:
The function of this protein remains unknown.Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
41kDaShipping Conditions:
Wet IceProtein Length:
352NCBI Gene Symbol:
NECAB1NCBI GB Accession Number:
Necab1Host or Source:
RabbitProtein Name:
N-terminal EF-hand calcium-binding protein 1Nucleotide Accession Number:
NM_178617Peptide Sequence:
HIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRY
