Lyrm4 Antibody - middle region : Biotin (ARP57407_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Lyrm4 Antibody - middle region : Biotin (ARP57407_P050-Biotin)
Gene Name:
LYR motif containing 4Gene Aliases:
Gm903, BC034664Gene ID:
380840Swiss Prot:
Q8K215Accession Number:
NP_958746Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Guinea Pig, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide corresponding to a region of MouseTarget:
Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
10kDaShipping Conditions:
Wet IceProtein Length:
91NCBI Gene Symbol:
LYRM4NCBI GB Accession Number:
Lyrm4Host or Source:
RabbitProtein Name:
LYR motif-containing protein 4Nucleotide Accession Number:
NM_201358Peptide Sequence:
VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI
