Dnajc27 Antibody - N-terminal region : FITC (ARP56937_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Dnajc27 Antibody - N-terminal region : FITC (ARP56937_P050-FITC)
Gene Name:
DnaJ (Hsp40) homolog, subfamily C, member 27Gene Aliases:
Ra, Rb, Rbj, Rabj, AI639580, C330021A05RikGene ID:
217378Swiss Prot:
Q8CFP6Accession Number:
NP_694722Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishTarget:
The function of this protein remains unknown.Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
30kDaShipping Conditions:
Wet IceProtein Length:
273NCBI Gene Symbol:
DNAJC27NCBI GB Accession Number:
Dnajc27Host or Source:
RabbitProtein Name:
DnaJ homolog subfamily C member 27Nucleotide Accession Number:
NM_153082Peptide Sequence:
DYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQK
