PYDC1 Antibody - N-terminal region : FITC (ARP55560_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PYDC1 Antibody - N-terminal region : FITC (ARP55560_P050-FITC)
Gene Name:
PYD (pyrin domain) containing 1Gene Aliases:
ASC2, POP1, PYC1, cPOP1Gene ID:
260434Swiss Prot:
Q8WXC3Accession Number:
NP_690865Host:
RabbitReactivity:
Human, Cow, Dog, Goat, Guinea Pig, Horse, YeastImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYDC1Target:
PYDC1 associates with apoptosis-associated specklike protein containing a CARD domain (ASC) and modulates its ability to collaborate with pyrin and cryopyrin in NF-kappa-B and pro- caspase-1 activation. It suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.Partner Proteins:
WDR82Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 83%; Dog: 83%; Goat: 83%; Guinea Pig: 85%; Horse: 83%; Human: 100%; Yeast: 77%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
9kDaShipping Conditions:
Wet IceProtein Length:
89NCBI Gene Symbol:
PYDC1NCBI GB Accession Number:
PYDC1Host or Source:
RabbitProtein Name:
Pyrin domain-containing protein 1Peptide Sequence:
REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD
