TCP11L2 Antibody - N-terminal region : FITC (ARP55541_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TCP11L2 Antibody - N-terminal region : FITC (ARP55541_P050-FITC)
Gene Name:
T-complex 11 (mouse) -like 2Gene Aliases:
MGC40368Gene ID:
255394Swiss Prot:
Q8N4U5Accession Number:
NP_689985Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TCP11L2Target:
The specific function of TCP11L2 is not yet known.Partner Proteins:
APPClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%; Zebrafish: 79%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
58kDaReferences & Citations:
Strausberg, R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903Shipping Conditions:
Wet IceProtein Length:
519NCBI Gene Symbol:
TCP11L2NCBI GB Accession Number:
TCP11L2Host or Source:
RabbitProtein Name:
T-complex protein 11-like protein 2Nucleotide Accession Number:
NM_152772Peptide Sequence:
VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC
