ARRDC4 Antibody - C-terminal region : FITC (ARP55325_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ARRDC4 Antibody - C-terminal region : FITC (ARP55325_P050-FITC)
Gene Name:
Arrestin domain containing 4Gene ID:
91947Swiss Prot:
Q8NCT1Accession Number:
NP_899232.2Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human ARRDC4Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 79%; Rat: 79%; Zebrafish: 79%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
36kDaShipping Conditions:
Wet IceProtein Length:
331NCBI Gene Symbol:
ARRDC4NCBI GB Accession Number:
ARRDC4Host or Source:
RabbitProtein Name:
Arrestin domain-containing protein 4Nucleotide Accession Number:
NM_183376.2Peptide Sequence:
PYPQPPNCEGEVCCPVFACIQEFRFQPPPLYSEVDPHPSDVEESQPVSFI
