CTF1 Antibody - N-terminal region : FITC (ARP51943_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CTF1 Antibody - N-terminal region : FITC (ARP51943_P050-FITC)
Gene Name:
Cardiotrophin 1Gene Aliases:
CT1, CT-1Gene ID:
1489Swiss Prot:
Q16619Accession Number:
NP_001321Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Horse, PigImmunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human CTF1Target:
CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.Partner Proteins:
MAGEA6; APP; EP300; IL6ST; LIFRClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 92%; Rat: 86%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
21kDaReferences & Citations:
Yu, M., (2008) Exp. Dermatol. 17 (1), 12-19Shipping Conditions:
Wet IceProtein Length:
201NCBI Gene Symbol:
CTF1NCBI GB Accession Number:
CTF1Host or Source:
RabbitProtein Name:
Cardiotrophin-1Nucleotide Accession Number:
NM_001330Peptide Sequence:
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
