DIRC2 Antibody - middle region : FITC (ARP50133_P050-FITC)

CAT:
247-ARP50133_P050-FITC
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
DIRC2 Antibody - middle region : FITC (ARP50133_P050-FITC) - image 1

DIRC2 Antibody - middle region : FITC (ARP50133_P050-FITC)

  • Gene Name:

    Disrupted in renal carcinoma 2
  • Gene Aliases:

    RCC4, DIRC2
  • Gene ID:

    84925
  • Swiss Prot:

    Q96SL1
  • Accession Number:

    NP_116228
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Guinea Pig, Horse, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human DIRC2
  • Target:

    DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.This gene encodes a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of this gene by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence and transcripts to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
  • Clonality:

    Polyclonal
  • Conjugation:

    FITC: Fluorescein Isothiocyanate
  • Type:

    Polyclonal Antibody
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/ml
  • Homology:

    Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    52kDa
  • References & Citations:

    Bodmer, D., (2002) Cancer Genet. Cytogenet. 136 (2), 95-100
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    478
  • NCBI Gene Symbol:

    DIRC2
  • NCBI GB Accession Number:

    DIRC2
  • Host or Source:

    Rabbit
  • Protein Name:

    Disrupted in renal carcinoma protein 2
  • Nucleotide Accession Number:

    NM_032839
  • Peptide Sequence:

    AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ