VSIR Antibody - N-terminal region : HRP (ARP49699_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


VSIR Antibody - N-terminal region : HRP (ARP49699_P050-HRP)
Gene Name:
V-set immunoregulatory receptorGene Aliases:
B7H5, GI24, B7-H5, Dies1, PD-1H, SISP1, VISTA, PP2135, C10orf54, DD1alphaGene ID:
64115Swiss Prot:
Q9H7M9Accession Number:
NP_071436Host:
RabbitReactivity:
Human, Cow, Dog, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human C10orf54Partner Proteins:
UBC; SMAD3; PLSCR1Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 85%; Dog: 86%; Horse: 92%; Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
34kDaReferences & Citations:
Wan, D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729Shipping Conditions:
Wet IceProtein Length:
311NCBI Gene Symbol:
VSIRNCBI GB Accession Number:
VSIRHost or Source:
RabbitProtein Name:
V-type immunoglobulin domain-containing suppressor of T-cell activationNucleotide Accession Number:
NM_022153Peptide Sequence:
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
