NMNAT3 Antibody - N-terminal region : HRP (ARP49144_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NMNAT3 Antibody - N-terminal region : HRP (ARP49144_P050-HRP)
Gene Name:
Nicotinamide nucleotide adenylyltransferase 3Gene Aliases:
PNAT3, FKSG76, PNAT-3Gene ID:
349565Swiss Prot:
Q96T66-2Accession Number:
NP_835471Host:
RabbitReactivity:
Human, Mouse, Rat, Guinea PigTarget:
This gene encodes a member of the nicotinamide/nicotinic acid mononucleotide adenylyltransferase family. These enzymes use ATP to catalyze the synthesis of nicotinamide adenine dinucleotide or nicotinic acid adenine dinucleotide from nicotinamide mononucleotide or nicotinic acid mononucleotide, respectively. The encoded protein is localized to mitochondria and may also play a neuroprotective role as a molecular chaperone. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Guinea Pig: 79%; Human: 100%; Mouse: 86%; Rat: 86%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
24kDaShipping Conditions:
Wet IceProtein Length:
215NCBI Gene Symbol:
NMNAT3NCBI GB Accession Number:
NMNAT3Host or Source:
RabbitProtein Name:
Nicotinamide mononucleotide adenylyltransferase 3Nucleotide Accession Number:
NM_178177Peptide Sequence:
QVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQ
