GAS8 Antibody - N-terminal region : HRP (ARP48016_P050-HRP)

• Gene Name:

  Growth arrest-specific 8

• Gene Aliases:

  DRC4, GAS11, CILD33

• Gene ID:

  2622

• Swiss Prot:

  O95995

• Accession Number:

  NP_001472

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human GAS8

• Target:

  This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

• Partner Proteins:

  IQCB1; TP63; TP73; CIAO1

• Clonality:

  Polyclonal

• Conjugation:

  HRP: Horseradish Peroxidase

• Type:

  Polyclonal Antibody

• Applications:

  WB

• Purification:

  Affinity Purified

• Sample Type:

  GAS8 is supported by BioGPS gene expression data to be expressed in MCF7

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

• Format:

  Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  56

• Shipping Conditions:

  Wet Ice

• Protein Length:

  478

• NCBI Gene Symbol:

  GAS8

• NCBI GB Accession Number:

  GAS8

• Host or Source:

  Rabbit

• Protein Name:

  Growth arrest-specific protein 8

• Nucleotide Accession Number:

  NM_001481

• Peptide Sequence:

  VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM