DBX2 Antibody - middle region : Biotin (ARP47493_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


DBX2 Antibody - middle region : Biotin (ARP47493_P050-Biotin)
Gene Name:
Developing brain homeobox 2Gene Aliases:
FLJ16139Gene ID:
440097Swiss Prot:
Q6ZNG2Accession Number:
NP_001004329Host:
RabbitReactivity:
Human, Rat, Cow, Dog, Guinea Pig, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DBX2Target:
The function remains unknown.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 93%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Rat: 85%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
36kDaReferences & Citations:
Pierani, A., (2001) Neuron 29 (2), 367-384Shipping Conditions:
Wet IceProtein Length:
339NCBI Gene Symbol:
DBX2NCBI GB Accession Number:
DBX2Host or Source:
RabbitProtein Name:
Homeobox protein DBX2Nucleotide Accession Number:
NM_001004329Peptide Sequence:
SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT
