NOX3 Antibody: FITC (ARP47185_P050-FITC)

CAT:
247-ARP47185_P050-FITC
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
NOX3 Antibody: FITC (ARP47185_P050-FITC) - image 1

NOX3 Antibody: FITC (ARP47185_P050-FITC)

  • Gene Name:

    NADPH oxidase 3
  • Gene Aliases:

    MOX-2, GP91-3
  • Gene ID:

    50508
  • Swiss Prot:

    Q9HBY0
  • Accession Number:

    NP_056533
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF
  • Target:

    This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.
  • Clonality:

    Polyclonal
  • Conjugation:

    FITC: Fluorescein Isothiocyanate
  • Type:

    Polyclonal Antibody
  • Applications:

    IHC
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/mL
  • Homology:

    Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
  • Format:

    Liquid. Purified antibody supplied in 1x PBS buffer.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    65 kDa
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    568
  • NCBI Gene Symbol:

    NOX3
  • Protein Name:

    NADPH oxidase 3
  • Nucleotide Accession Number:

    NM_015718