PIP3-E Antibody - C-terminal region : Biotin (ARP46229_T100-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PIP3-E Antibody - C-terminal region : Biotin (ARP46229_T100-Biotin)
Gene Name:
Interaction protein for cytohesin exchange factors 1Gene Aliases:
PIP3-EGene ID:
26034Swiss Prot:
Q8WWN9Accession Number:
EAW47702Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PIP3-ETarget:
PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.Partner Proteins:
CYTH2; CYTH4; CYTH1; CYTH3Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBConcentration:
0.5 mg/mlHomology:
Human: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
44kDaShipping Conditions:
Wet IceProtein Length:
409NCBI Gene Symbol:
IPCEF1NCBI GB Accession Number:
IPCEF1Host or Source:
RabbitProtein Name:
Interactor protein for cytohesin exchange factors 1Nucleotide Accession Number:
NM_001130699Peptide Sequence:
DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS
