MST1 Antibody - N-terminal region : FITC (ARP45722_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


MST1 Antibody - N-terminal region : FITC (ARP45722_P050-FITC)
Gene Name:
Macrophage stimulating 1 (hepatocyte growth factor-like)Gene Aliases:
MSP, HGFL, NF15S2, D3F15S2, DNF15S2Gene ID:
4485Swiss Prot:
P26927Accession Number:
NP_066278Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MST1Target:
The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.Partner Proteins:
FOXO1; HIST2H2BE; MST1; DAXX; MOB1A; MST1R; KLKB1; SERPINA3Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WB, IHCPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
80kDaShipping Conditions:
Wet IceProtein Length:
711NCBI Gene Symbol:
MST1NCBI GB Accession Number:
MST1Host or Source:
RabbitProtein Name:
Hepatocyte growth factor-like proteinNucleotide Accession Number:
NM_020998Peptide Sequence:
TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
