Atp11c Antibody - C-terminal region : FITC (ARP44611_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Atp11c Antibody - C-terminal region : FITC (ARP44611_P050-FITC)
Gene Name:
ATPase, class VI, type 11CGene Aliases:
I, Ig, AI315324, A330005H02RikGene ID:
320940Swiss Prot:
Q9QZW0Accession Number:
NP_001032952Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide corresponding to a region of MouseTarget:
The function of Atp11c remains unknown.Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
129kDaShipping Conditions:
Wet IceProtein Length:
1129NCBI Gene Symbol:
ATP11CNCBI GB Accession Number:
Atp11cHost or Source:
RabbitProtein Name:
Probable phospholipid-transporting ATPase 11CNucleotide Accession Number:
NM_001037863Peptide Sequence:
GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH
