SLC25A30 Antibody - N-terminal region : FITC (ARP43770_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SLC25A30 Antibody - N-terminal region : FITC (ARP43770_P050-FITC)
Gene Name:
Solute carrier family 25, member 30Gene Aliases:
KMCP1Gene ID:
253512Swiss Prot:
Q5SVS4Accession Number:
NP_001010875Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC25A30Target:
Although the outer mitochondrial membrane is permeable to many small metabolites, transport of solutes across the inner mitochondrial membrane is achieved by members of the mitochondrial carrier protein family, such as SLC25A30.Partner Proteins:
UBCClonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
32kDaShipping Conditions:
Wet IceProtein Length:
291NCBI Gene Symbol:
SLC25A30NCBI GB Accession Number:
SLC25A30Host or Source:
RabbitProtein Name:
Kidney mitochondrial carrier protein 1Peptide Sequence:
GTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSG
