Gnmt Antibody - N-terminal region : Biotin (ARP43564_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Gnmt Antibody - N-terminal region : Biotin (ARP43564_P050-Biotin)
Gene Name:
Glycine N-methyltransferaseGene ID:
14711Swiss Prot:
Q9QXF8Accession Number:
NP_034451Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishTarget:
Gnmt catalyzes the methylation of glycine by using S-adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy) . It plays a possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine.Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
33kDaShipping Conditions:
Wet IceProtein Length:
293NCBI Gene Symbol:
GNMTNCBI GB Accession Number:
GnmtHost or Source:
RabbitProtein Name:
Glycine N-methyltransferaseNucleotide Accession Number:
NM_010321Peptide Sequence:
GVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRV
