CRNN Antibody - middle region : Biotin (ARP42460_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


CRNN Antibody - middle region : Biotin (ARP42460_P050-Biotin)
Gene Name:
CornulinGene Aliases:
DRC1, PDRC1, SEP53, C1orf10Gene ID:
49860Swiss Prot:
Q9UBG3Accession Number:
NP_057274Host:
RabbitReactivity:
Human, Dog, HorseImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CRNNTarget:
This gene encodes a member of the "fused gene" family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.Partner Proteins:
WWOX; ZBTB1Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Dog: 85%; Horse: 79%; Human: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
52kDaShipping Conditions:
Wet IceProtein Length:
481NCBI Gene Symbol:
CRNNNCBI GB Accession Number:
CRNNHost or Source:
RabbitProtein Name:
CornulinNucleotide Accession Number:
NM_016190Peptide Sequence:
GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
