RBPMS2 Antibody - middle region : HRP (ARP41199_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RBPMS2 Antibody - middle region : HRP (ARP41199_P050-HRP)
Gene Name:
RNA binding protein with multiple splicing 2Gene ID:
348093Swiss Prot:
Q6ZRY4Accession Number:
NP_919248Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2Target:
RBPMS2 contains 1 RRM (RNA recognition motif) domain. The exact function of RBPMS2 remains unknown.Partner Proteins:
VHL; UBCClonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%; Zebrafish: 93%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
22kDaShipping Conditions:
Wet IceProtein Length:
209NCBI Gene Symbol:
RBPMS2NCBI GB Accession Number:
RBPMS2Host or Source:
RabbitProtein Name:
RNA-binding protein with multiple splicing 2Nucleotide Accession Number:
NM_194272Peptide Sequence:
ANTKMAKSKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAP
