NIP7 Antibody - C-terminal region : HRP (ARP40833_T100-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NIP7 Antibody - C-terminal region : HRP (ARP40833_T100-HRP)
Gene Name:
Nuclear import 7 homolog (S. cerevisiae)Gene Aliases:
KD93, CGI-37, HSPC031Gene ID:
51388Swiss Prot:
Q9Y221Accession Number:
NP_057185Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, ZebrafishImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NIP7Target:
NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.Partner Proteins:
LZTS2; NECAB2; NIP7; CRX; SOX2; UBC; ELAVL1; NOL8; ZBED1Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
IHC, WBSample Type:
NIP7 is supported by BioGPS gene expression data to be expressed in HepG2Concentration:
0.5 mg/mlHomology:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 79%; Zebrafish: 79%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
20kDaReferences & Citations:
Oh, J.H., (2005) Mamm. Genome 16 (12), 942-954Shipping Conditions:
Wet IceProtein Length:
180NCBI Gene Symbol:
NIP7NCBI GB Accession Number:
NIP7Host or Source:
RabbitProtein Name:
60S ribosome subunit biogenesis protein NIP7 homologNucleotide Accession Number:
NM_016101Peptide Sequence:
VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLTSubunit:
Biogenesis protein NIP7 homolog
