FOXK2 Antibody - C-terminal region : HRP (ARP40032_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FOXK2 Antibody - C-terminal region : HRP (ARP40032_P050-HRP)
Gene Name:
Forkhead box K2Gene Aliases:
ILF, ILF1, ILF-1, nGTBPGene ID:
3607Swiss Prot:
Q01167Accession Number:
AAB02822Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXK2Target:
FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements.Partner Proteins:
HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Human: 100%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
34kDaShipping Conditions:
Wet IceProtein Length:
323NCBI Gene Symbol:
FOXK2NCBI GB Accession Number:
FOXK2Host or Source:
RabbitProtein Name:
Forkhead box protein K2Nucleotide Accession Number:
NM_004514Peptide Sequence:
DKQLTLNGIYTHITKNYPYYRTADKGWQRGESFAHVGNTRIRIGLPAHKA
