TCEAL9 Antibody - middle region : HRP (ARP39247_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


TCEAL9 Antibody - middle region : HRP (ARP39247_P050-HRP)
Gene Name:
Transcription elongation factor A like 9Gene Aliases:
WBP5, WEX6Gene ID:
51186Swiss Prot:
Q9UHQ7Accession Number:
NP_057387Host:
RabbitReactivity:
Human, Rat, Cow, Horse, Pig, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human WBP5Target:
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.Partner Proteins:
UBC; PRPF40A; KDELR1; SDCCAG3; USP11; RPL31Clonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 100%; Rat: 93%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
13kDaShipping Conditions:
Wet IceProtein Length:
104NCBI Gene Symbol:
TCEAL9NCBI GB Accession Number:
TCEAL9Host or Source:
RabbitProtein Name:
Transcription elongation factor A protein-like 9Nucleotide Accession Number:
NM_016303Peptide Sequence:
TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK
