ZNF202 Antibody - C-terminal region : FITC (ARP38352_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ZNF202 Antibody - C-terminal region : FITC (ARP38352_P050-FITC)
Gene Name:
Zinc finger protein 202Gene Aliases:
ZSCAN42, ZKSCAN10Gene ID:
7753Swiss Prot:
O95125Accession Number:
NP_001288708.1Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Horse, Pig, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF202Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 93%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
42kDaShipping Conditions:
Wet IceProtein Length:
386NCBI Gene Symbol:
ZNF202NCBI GB Accession Number:
ZNF202Host or Source:
RabbitProtein Name:
Zinc finger protein 202Nucleotide Accession Number:
NM_001301779.1Peptide Sequence:
LIKHQRAHAGGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRG
