ZNF175 Antibody - N-terminal region : FITC (ARP35832_P050-FITC)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ZNF175 Antibody - N-terminal region : FITC (ARP35832_P050-FITC)
Gene Name:
Zinc finger protein 175Gene Aliases:
OTK18Gene ID:
7728Swiss Prot:
Q9Y473Accession Number:
NP_009078Host:
RabbitReactivity:
HumanImmunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF175Target:
ZNF175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis. As a transcriptional suppressor, this protein plays a role in macrophage control of viral replication during advanced HIV-1 infection.Partner Proteins:
KRTAP10-7; ZNF250; ZNF264; PSTPIP1; ALAS1; LPXN; UBC; LZTR1; CDC42Clonality:
PolyclonalConjugation:
FITC: Fluorescein IsothiocyanateType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Human: 100%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
82kDaReferences & Citations:
Carlson, K.A., et al., (2004) J. Neuroimmunol. 150 (1-2), 186-198Shipping Conditions:
Wet IceProtein Length:
711NCBI Gene Symbol:
ZNF175NCBI GB Accession Number:
ZNF175Host or Source:
RabbitProtein Name:
Zinc finger protein 175Nucleotide Accession Number:
NM_007147Peptide Sequence:
MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC
