TRPM3 Antibody: HRP (ARP35604_P050-HRP)

• Gene Name:

  Transient receptor potential cation channel, subfamily M, member 3

• Gene Aliases:

  GON-2, MLSN2, LTRPC3

• Gene ID:

  80036

• Swiss Prot:

  Q9HCF6

• Accession Number:

  NP_996827

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

• Immunogen:

  The immunogen is a synthetic peptide directed towards the following sequence DISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQ

• Target:

  The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.

• Clonality:

  Polyclonal

• Conjugation:

  HRP: Horseradish Peroxidase

• Type:

  Polyclonal Antibody

• Purification:

  Affinity Purified

• Concentration:

  0.5 mg/mL

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

• Format:

  Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  198 kDa

• Shipping Conditions:

  Wet Ice

• Protein Length:

  1732

• NCBI Gene Symbol:

  TRPM3

• Protein Name:

  Transient receptor potential cation channel subfamily M member 3

• Nucleotide Accession Number:

  NM_001007470