IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP)
Gene Name:
IKAROS family zinc finger 1 (Ikaros)Gene Aliases:
IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452Gene ID:
10320Swiss Prot:
Q13422Accession Number:
NP_006051Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, RabbitImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IKZF1Target:
IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.Partner Proteins:
PRKAB2; PIN1; FGF12; DDX6; DCX; CTBP2; CTBP1; CKS1B; BYSL; FAM74A4; C1orf174; CEP57L1; ALKBH3; ZMAT2; ZNF417; FRMD6; SPATC1L; FAM161A; FAM214B; ARMC7; NOC4L; SCNM1; C8orf33; AEN; GMCL1P1; KIF9; SH2D4A; CBX8; LMO3; C19orf66; C1orf109; SYT17; ZNF581; FAM50BClonality:
PolyclonalConjugation:
HRP: Horseradish PeroxidaseType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
57kDaReferences & Citations:
Loeper, S., (2008) Cancer Res. 68 (10), 3715-3723Shipping Conditions:
Wet IceProtein Length:
519NCBI Gene Symbol:
IKZF1NCBI GB Accession Number:
IKZF1Host or Source:
RabbitProtein Name:
DNA-binding protein IkarosNucleotide Accession Number:
NM_006060Peptide Sequence:
DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK
