IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP)

CAT:
247-ARP31470_P050-HRP
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP) - image 1

IKZF1 Antibody - middle region : HRP (ARP31470_P050-HRP)

  • Gene Name:

    IKAROS family zinc finger 1 (Ikaros)
  • Gene Aliases:

    IK1, LYF1, LyF-1, CVID13, IKAROS, PPP1R92, PRO0758, ZNFN1A1, Hs.54452
  • Gene ID:

    10320
  • Swiss Prot:

    Q13422
  • Accession Number:

    NP_006051
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the middle region of human IKZF1
  • Target:

    IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.
  • Partner Proteins:

    PRKAB2; PIN1; FGF12; DDX6; DCX; CTBP2; CTBP1; CKS1B; BYSL; FAM74A4; C1orf174; CEP57L1; ALKBH3; ZMAT2; ZNF417; FRMD6; SPATC1L; FAM161A; FAM214B; ARMC7; NOC4L; SCNM1; C8orf33; AEN; GMCL1P1; KIF9; SH2D4A; CBX8; LMO3; C19orf66; C1orf109; SYT17; ZNF581; FAM50B
  • Clonality:

    Polyclonal
  • Conjugation:

    HRP: Horseradish Peroxidase
  • Type:

    Polyclonal Antibody
  • Applications:

    WB
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/ml
  • Homology:

    Cow: 92%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
  • Format:

    Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    57kDa
  • References & Citations:

    Loeper, S., (2008) Cancer Res. 68 (10), 3715-3723
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    519
  • NCBI Gene Symbol:

    IKZF1
  • NCBI GB Accession Number:

    IKZF1
  • Host or Source:

    Rabbit
  • Protein Name:

    DNA-binding protein Ikaros
  • Nucleotide Accession Number:

    NM_006060
  • Peptide Sequence:

    DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK