NANOG Antibody - middle region : Biotin (ARP30891_P050-Biotin)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


NANOG Antibody - middle region : Biotin (ARP30891_P050-Biotin)
Gene Name:
Nanog homeoboxGene ID:
79923Swiss Prot:
Q6NSW7Accession Number:
NP_079141Host:
RabbitReactivity:
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, SheepImmunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NANOGTarget:
NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.Partner Proteins:
DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12Clonality:
PolyclonalConjugation:
BiotinType:
Polyclonal AntibodyApplications:
WBPurification:
Affinity PurifiedConcentration:
0.5 mg/mlHomology:
Cow: 86%; Dog: 93%; Goat: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 92%; Sheep: 86%Format:
Liquid. Purified antibody supplied in 1x PBS buffer.Reconstitution:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.Molecular Weight:
34kDaShipping Conditions:
Wet IceProtein Length:
305NCBI Gene Symbol:
NANOGNCBI GB Accession Number:
NANOGHost or Source:
RabbitProtein Name:
Putative homeobox protein NANOGP8Nucleotide Accession Number:
NM_024865Peptide Sequence:
SYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQG
