Recombinant Human Proteoglycan 4 (PRG4) , partial
CAT:
399-CSB-YP018672HU-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Proteoglycan 4 (PRG4) , partial
- CAS Number: 9000-83-3
- Gene Name: Prg4
- UniProt: Q92954
- Expression Region: 25-156aa
- Organism: Homo sapiens
- Target Sequence: QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
- Tag: N-terminal 6xHis-tagged
- Source: Yeast
- Field of Research: Signal Transduction
- Assay Type: In Stock Protein
- Relevance: Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface. Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.
- Purity: Greater than 85% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 16.8 kDa
- References & Citations: "Purification, biochemical characterization, and cloning of a novel megakaryocyte stimulating factor that has megakaryocyte colony stimulating activity." Turner K.J., Fitz L.J., Temple P., Jacobs K., Larson D., Leary A.C., Kelleher K., Giannotti J., Calvetti J., Fitzgerald M., Kriz M.-J., Ferenz C., Grobholz J., Fraser H., Bean K., Norton C.R., Gesner T., Bhatia S. Clark S.C. Blood 78:279A-279A (1991)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.