Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial (Active)
CAT:
399-CSB-MP010949HU-03
Size:
1 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial (Active)
Product Name Alternative:
Intercellular adhesion molecule 1, ICAM-1, Major group rhinovirus receptor, CD54, ICAM1Gene Name:
ICAM1UniProt:
P05362Expression Region:
28-480aaOrganism:
Homo sapiens (Human)Tag:
C-terminal 10xHis-taggedType:
Active Protein & In Stock ProteinSource:
Mammalian cellField of Research:
ImmunologyEndotoxin:
Less than 1.0 EU/µg as determined by LAL method.Purity:
Greater than 95% as determined by SDS-PAGE.Bioactivity:
Measured by its binding ability in a functional ELISA. Immobilized Human ICAM1 at 2 μg/mL can bind Anti-ICAM1 recombinant antibody (CSB-RA010949MA1HU) . The EC50 is 0.2350-0.4911 ng/mL.Form:
Lyophilized powderBuffer:
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
50.9 kDaReferences & Citations:
Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080 (2005)Shelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Transmembrane Domains:
0TMProtein Length:
PartialTarget Description:
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE