Recombinant Mouse Pituitary homeobox 1 (Pitx1)

CAT:
399-CSB-EP018042MO-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Pituitary homeobox 1 (Pitx1) - image 1

Recombinant Mouse Pituitary homeobox 1 (Pitx1)

  • Product Name Alternative:

    Hindlimb-expressed homeobox protein backfoot; Homeobox protein P-OTX; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1; Pituitary OTX-related factor
  • Abbreviation:

    Recombinant Mouse Pitx1 protein
  • Gene Name:

    Pitx1
  • UniProt:

    P70314
  • Expression Region:

    1-315aa
  • Organism:

    Mus musculus (Mouse)
  • Target Sequence:

    MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
  • Tag:

    C-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    Sequence-specific transcription factor that binds gene promoters and activates their transcription. May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. Can independently activate and synergize with PIT-1 on pituitary-specific target gene promoters, thus may subserve functions in generating both precursor and specific cell phenotypes in the anterior pituitary gland and in several other organs. Can activate pituitary transcription of the proopiomelanocortin gene
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    40.9 kDa
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length