Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)

CAT:
399-CSB-MP015551MOV1j8-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active) - image 1

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)

  • Product Name Alternative:

    Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein (NK-p30; NKp30) ; CD337; NCR3
  • Abbreviation:

    Recombinant Cynomolgus monkey NCR3 protein, partial (Active)
  • Gene Name:

    NCR3
  • UniProt:

    P61483
  • Expression Region:

    19-135aa
  • Organism:

    Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
  • Target Sequence:

    LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG
  • Tag:

    C-terminal hFc1-avi-tagged
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Immunology
  • Relevance:

    Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3LG1 (CSB-MP4942MOV) at 5 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3. The EC50 is 1.171-1.377 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    42.0 kDa
  • References & Citations:

    Identification, molecular cloning and functional characterization of NKp46 and NKp30 natural cytotoxicity receptors in Macaca fascicularis NK cells. De Maria A., Biassoni R., Fogli M., Rizzi M., Cantoni C., Costa P., Conte R., Mavilio D., Ensoli B., Moretta L. Eur. J. Immunol. 31:3546-3556 (2001)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial