Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)
CAT:
399-CSB-MP011916MO1-01
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)
Product Name Alternative:
Inositol 1,4, 5-trisphosphate receptor-interacting protein-like 1, Itpripl1Gene Name:
Itpripl1UniProt:
A2ASA8Expression Region:
23-96aaOrganism:
Mus musculus (Mouse)Tag:
C-terminal 10xHis-taggedType:
Active Protein & In Stock ProteinSource:
Mammalian cellField of Research:
OthersEndotoxin:
Less than 1.0 EU/µg as determined by LAL method.Purity:
Greater than 95% as determined by SDS-PAGE.Bioactivity:
Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU) . The EC50 is 0.7534-0.9877 ng/mL.Form:
Lyophilized powderBuffer:
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.Molecular Weight:
10.0 kDaReferences & Citations:
ITPRIPL1 binds CD3epsilon to impede T cell activation and enable tumor immune evasion. Deng S., Zhang Y., Wang H., Liang W., Xie L., Li N., Fang Y., Wang Y., Liu J., Xu J. Cell 187:2305-2323.e33 (2024)Shelf Life:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.Protein Length:
PartialTarget Description:
DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG