Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

CAT:
399-CSB-MP018988HU-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active) - image 1

Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

  • Product Name Alternative:

    Parathyroid hormone/parathyroid hormone-related peptide receptor, PTH/PTHrP type I receptor (PTH/PTHr receptor), Parathyroid hormone 1 receptor (PTH1 receptor), PTH1R, PTHR, PTHR1
  • Gene Name:

    PTH1R
  • UniProt:

    Q03431
  • Expression Region:

    27-188aa
  • Organism:

    Homo sapiens (Human)
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Signal Transduction
  • Endotoxin:

    Less than 1.0 EU/µg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU) . The EC50 is 0.7813-1.048 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    20.3 kDa
  • References & Citations:

    Identical complementary deoxyribonucleic acids encode a human renal and bone parathyroid hormone (PTH) /PTH-related peptide receptor. Schipani E., Karga H., Karaplis A.C., Potts J.T. Jr., Kronenberg H.M., Abou-Samra A.-B., Segre G.V., Jueppner H. Endocrinology 132:2157-2165 (1993)
  • Shelf Life:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial
  • Target Description:

    DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG